C12orf70 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20716
Artikelname: C12orf70 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20716
Hersteller Artikelnummer: PAB20716
Alternativnummer: ABN-PAB20716-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human C12orf70.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant C12orf70.
UniProt: 341346
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: LKKKVIERLEDLCKNVELLSAKLRMYQMEAEDTDSHSSEEIDTEEMEALLPQAPASFLVQKSPPRNTAWKR
Target-Kategorie: C12orf70
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.