OPALIN polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20717
Artikelname: OPALIN polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20717
Hersteller Artikelnummer: PAB20717
Alternativnummer: ABN-PAB20717-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human OPALIN.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant OPALIN.
UniProt: 93377
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
Target-Kategorie: OPALIN
Application Verdünnung: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.