TMEM200A polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20721
Artikelname: TMEM200A polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20721
Hersteller Artikelnummer: PAB20721
Alternativnummer: ABN-PAB20721-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMEM200A.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMEM200A.
UniProt: 114801
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: EHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKM
Target-Kategorie: TMEM200A
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.