KIAA0513 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20724
Artikelname: KIAA0513 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20724
Hersteller Artikelnummer: PAB20724
Alternativnummer: ABN-PAB20724-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human KIAA0513.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant KIAA0513.
UniProt: 9764
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PVGSLIDFGPEAPTSSPLEAPPPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGE
Target-Kategorie: KIAA0513
Application Verdünnung: Immunohistochemistry (1:20-1:50)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.