GSG1L polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20730
Artikelname: GSG1L polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20730
Hersteller Artikelnummer: PAB20730
Alternativnummer: ABN-PAB20730-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human GSG1L.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant GSG1L.
UniProt: 146395
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: QGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV
Target-Kategorie: GSG1L
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.