LRRC66 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20740
Artikelname: LRRC66 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20740
Hersteller Artikelnummer: PAB20740
Alternativnummer: ABN-PAB20740-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human LRRC66.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant LRRC66.
UniProt: 339977
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: GTEQSLWDSQMEFSKERQVSSSIDLLSIQQPRLSGARAEEALSAHYSEVPYGDPRDTGPSVFPPRWDSGLDVTPANKEPVQKSTPSDTCCELESDCDSDEGSLFTLSSISSESARSKTEEAVPDEESLQDESSGASKD
Target-Kategorie: LRRC66
Application Verdünnung: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.