C10orf118 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20742
Artikelname: C10orf118 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20742
Hersteller Artikelnummer: PAB20742
Alternativnummer: ABN-PAB20742-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human C10orf118.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant C10orf118.
UniProt: 55088
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: LRSSTFPESANEKTYSESPYDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRVPNGMNKGEHALVLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDICSEKDNLREELKKRTETEK
Target-Kategorie: C10orf118
Application Verdünnung: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.