C9orf123 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20745
Artikelname: C9orf123 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20745
Hersteller Artikelnummer: PAB20745
Alternativnummer: ABN-PAB20745-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human C9orf123.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant C9orf123.
UniProt: 90871
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Target-Kategorie: C9orf123
Application Verdünnung: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.