SFT2D1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20752
Artikelname: SFT2D1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20752
Hersteller Artikelnummer: PAB20752
Alternativnummer: ABN-PAB20752-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human SFT2D1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant SFT2D1.
UniProt: 113402
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRL
Target-Kategorie: SFT2D1
Application Verdünnung: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.