YIF1A polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20773
Artikelname: YIF1A polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20773
Hersteller Artikelnummer: PAB20773
Alternativnummer: ABN-PAB20773-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human YIF1A.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant YIF1A.
UniProt: 10897
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Target-Kategorie: YIF1A
Application Verdünnung: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.