MPDU1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20774
Artikelname: MPDU1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20774
Hersteller Artikelnummer: PAB20774
Alternativnummer: ABN-PAB20774-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human MPDU1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant MPDU1.
UniProt: 9526
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Target-Kategorie: MPDU1
Application Verdünnung: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.