HADHA polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20813
Artikelname: HADHA polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20813
Hersteller Artikelnummer: PAB20813
Alternativnummer: ABN-PAB20813-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human HADHA.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant HADHA.
UniProt: 3030
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Target-Kategorie: HADHA
Application Verdünnung: Immunohistochemistry (1:20-1:50)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.