APOBEC4 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20829
Artikelname: APOBEC4 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20829
Hersteller Artikelnummer: PAB20829
Alternativnummer: ABN-PAB20829-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human APOBEC4.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant APOBEC4.
UniProt: 403314
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC
Target-Kategorie: APOBEC4
Application Verdünnung: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.