CISD2 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20855
Artikelname: CISD2 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20855
Hersteller Artikelnummer: PAB20855
Alternativnummer: ABN-PAB20855-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human CISD2.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CISD2.
UniProt: 493856
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Target-Kategorie: CISD2
Application Verdünnung: Immunohistochemistry (1:50-1:200)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.