ZDHHC3 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20891
Artikelname: ZDHHC3 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20891
Hersteller Artikelnummer: PAB20891
Alternativnummer: ABN-PAB20891-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human ZDHHC3.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant ZDHHC3.
UniProt: 51304
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPTT
Target-Kategorie: ZDHHC3
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.