GP2 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20897
Artikelname: GP2 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20897
Hersteller Artikelnummer: PAB20897
Alternativnummer: ABN-PAB20897-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human GP2.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant GP2.
UniProt: 2813
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
Target-Kategorie: GP2
Application Verdünnung: Immunohistochemistry (1:1000-1:2500)The optimal working dilution should be determined by the end user.