HNRNPH2 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20912
Artikelname: HNRNPH2 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20912
Hersteller Artikelnummer: PAB20912
Alternativnummer: ABN-PAB20912-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human HNRNPH2.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant HNRNPH2.
UniProt: 3188
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS
Target-Kategorie: HNRNPH2
Application Verdünnung: Immunohistochemistry (1:20-1:50)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.