FAM73A polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20948
Artikelname: FAM73A polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20948
Hersteller Artikelnummer: PAB20948
Alternativnummer: ABN-PAB20948-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human FAM73A.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant FAM73A.
UniProt: 374986
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: QEEFEATLGASDPNSLADDIDKDTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANR
Target-Kategorie: FAM73A
Application Verdünnung: Immunohistochemistry (1:10-1:20)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.