GPC6 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20952
Artikelname: GPC6 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20952
Hersteller Artikelnummer: PAB20952
Alternativnummer: ABN-PAB20952-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human GPC6.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant GPC6.
UniProt: 10082
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: KGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEK
Target-Kategorie: GPC6
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.