DOCK5 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20955
Artikelname: DOCK5 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20955
Hersteller Artikelnummer: PAB20955
Alternativnummer: ABN-PAB20955-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human DOCK5.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant DOCK5.
UniProt: 80005
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL
Target-Kategorie: DOCK5
Application Verdünnung: Immunofluorescence (0.25-2 ug/mL)The optimal working dilution should be determined by the end user.