DOCK5 polyclonal antibody, Rabbit
Artikelnummer:
ABN-PAB20955
Artikelname: |
DOCK5 polyclonal antibody, Rabbit |
Artikelnummer: |
ABN-PAB20955 |
Hersteller Artikelnummer: |
PAB20955 |
Alternativnummer: |
ABN-PAB20955-100 |
Hersteller: |
Abnova |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IF |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant protein corresponding to amino acids of human DOCK5. |
Alternative Synonym: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against recombinant DOCK5. |
UniProt: |
80005 |
Puffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Formulierung: |
Liquid |
Sequenz: |
VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL |
Target-Kategorie: |
DOCK5 |
Application Verdünnung: |
Immunofluorescence (0.25-2 ug/mL)The optimal working dilution should be determined by the end user. |