CNNM4 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20959
Artikelname: CNNM4 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20959
Hersteller Artikelnummer: PAB20959
Alternativnummer: ABN-PAB20959-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human CNNM4.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CNNM4.
UniProt: 26504
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
Target-Kategorie: CNNM4
Application Verdünnung: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.