LRRC73 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24513
Artikelname: LRRC73 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24513
Hersteller Artikelnummer: PAB24513
Alternativnummer: ABN-PAB24513-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human LRRC73.
Rabbit polyclonal antibody raised against recombinant LRRC73.
UniProt: 221424
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGS
Target-Kategorie: LRRC73
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.