SCAF1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24516
Artikelname: SCAF1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24516
Hersteller Artikelnummer: PAB24516
Alternativnummer: ABN-PAB24516-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human SCAF1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant SCAF1.
UniProt: 58506
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Target-Kategorie: SCAF1
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.