RPP25 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24518
Artikelname: RPP25 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24518
Hersteller Artikelnummer: PAB24518
Alternativnummer: ABN-PAB24518-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human RPP25.
Rabbit polyclonal antibody raised against recombinant RPP25.
UniProt: 54913
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
Target-Kategorie: RPP25
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.