DDX27 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24527
Artikelname: DDX27 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24527
Hersteller Artikelnummer: PAB24527
Alternativnummer: ABN-PAB24527-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human DDX27.
Rabbit polyclonal antibody raised against recombinant DDX27.
UniProt: 55661
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Target-Kategorie: DDX27
Application Verdünnung: Immunohistochemistry (1:10-1:20)The optimal working dilution should be determined by the end user.