ZFP57 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24530
Artikelname: ZFP57 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24530
Hersteller Artikelnummer: PAB24530
Alternativnummer: ABN-PAB24530-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human ZFP57.
Rabbit polyclonal antibody raised against recombinant ZFP57.
UniProt: 346171
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF
Target-Kategorie: ZFP57
Application Verdünnung: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.