CNPY1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24533
Artikelname: CNPY1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24533
Hersteller Artikelnummer: PAB24533
Alternativnummer: ABN-PAB24533-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human CNPY1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CNPY1.
UniProt: 285888
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
Target-Kategorie: CNPY1
Application Verdünnung: Immunohistochemistry (1:500-1:1000)The optimal working dilution should be determined by the end user.