OAF polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24535
Artikelname: OAF polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24535
Hersteller Artikelnummer: PAB24535
Alternativnummer: ABN-PAB24535-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human OAF.
Rabbit polyclonal antibody raised against recombinant OAF.
UniProt: 220323
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ
Target-Kategorie: OAF
Application Verdünnung: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.