DUSP28 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24539
Artikelname: DUSP28 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24539
Hersteller Artikelnummer: PAB24539
Alternativnummer: ABN-PAB24539-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human DUSP28.
Rabbit polyclonal antibody raised against recombinant DUSP28.
UniProt: 285193
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: GACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
Target-Kategorie: DUSP28
Application Verdünnung: Immunohistochemistry (1:10-1:20)The optimal working dilution should be determined by the end user.