ZC3HAV1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB24543
Artikelname: ZC3HAV1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB24543
Hersteller Artikelnummer: PAB24543
Alternativnummer: ABN-PAB24543-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human ZC3HAV1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant ZC3HAV1.
UniProt: 56829
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL
Target-Kategorie: ZC3HAV1
Application Verdünnung: Immunohistochemistry (1:20-1:50)The optimal working dilution should be determined by the end user.