ZNF275 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB27456
Artikelname: ZNF275 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB27456
Hersteller Artikelnummer: PAB27456
Alternativnummer: ABN-PAB27456-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human ZNF275.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant ZNF275.
UniProt: 10838
Puffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: WECGDCGKVFRGVAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACKACSRDF
Target-Kategorie: ZNF275
Application Verdünnung: Immunohistochemistry (1:50-1:200)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.