EMID1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB27457
Artikelname: EMID1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB27457
Hersteller Artikelnummer: PAB27457
Alternativnummer: ABN-PAB27457-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human EMID1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant EMID1.
UniProt: 129080
Puffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: RNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKIVTAREWRCCPGHSGVSCEEVAASSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVLEAKMTMLTVIEQPVPPTPAT
Target-Kategorie: EMID1
Application Verdünnung: Immunohistochemistry (1:50-1:200)Western Blot (1:100-1:250)The optimal working dilution should be determined by the end user.