MAGED4B polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB27461
Artikelname: MAGED4B polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB27461
Hersteller Artikelnummer: PAB27461
Alternativnummer: ABN-PAB27461-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human MAGED4B.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant MAGED4B.
UniProt: 81557
Puffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: AEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAA
Target-Kategorie: MAGED4B
Application Verdünnung: Immunohistochemistry (1200-1:500)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.