NME1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB27463
Artikelname: NME1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB27463
Hersteller Artikelnummer: PAB27463
Alternativnummer: ABN-PAB27463-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human NME1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant NME1.
UniProt: 4830
Puffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Target-Kategorie: NME1
Application Verdünnung: Immunohistochemistry (1:20-1:50)Immunofluorescence (0.25-2 ug/mL)Western Blot (0.04-0.4 ug/mL)The optimal working dilution should be determined by the end user.