GLOD5 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB27465
Artikelname: GLOD5 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB27465
Hersteller Artikelnummer: PAB27465
Alternativnummer: ABN-PAB27465-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human GLOD5.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant GLOD5.
UniProt: 392465
Puffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNY
Target-Kategorie: GLOD5
Application Verdünnung: Immunohistochemistry (1:50-1:200)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.