Anti-Caspase 8 Picoband Antibody, Rabbit, Polyclonal

Artikelnummer: ABT-ABO10010
Artikelname: Anti-Caspase 8 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer: ABT-ABO10010
Hersteller Artikelnummer: ABO10010
Alternativnummer: ABT-ABO10010-100UG
Hersteller: Abcepta
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB, IHC-P
Spezies Reaktivität: Human, Rat, Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids.
Alternative Synonym: Caspase-8, CASP-8, 3.4.22.61, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, FLICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, MACH, Caspase-8 subunit p18, Caspase-
Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Klonalität: Polyclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molekulargewicht: 55391
Antibody Type: Polyclonal Antibody
Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.