Anti-HMGB1 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-HMGB1 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10014
• Hersteller Artikelnummer: ABO10014
• Alternativnummer: ABT-ABO10014-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
• Alternative Synonym: High mobility group protein B1, High mobility group protein 1, HMG-1, HMGB1, HMG1

Produktbeschreibung

Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 24894
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder