Anti-IRF7 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-IRF7 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10022
• Hersteller Artikelnummer: ABO10022
• Alternativnummer: ABT-ABO10022-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IRF7 (31-67aa QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR), different from the related mouse sequence by seven amino acids.
• Alternative Synonym: Interferon regulatory factor 7, IRF-7, IRF7

Produktbeschreibung

Rabbit IgG polyclonal antibody for Interferon regulatory factor 7(IRF7) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 54278
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder