Anti-Bax Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-Bax Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10036
• Hersteller Artikelnummer: ABO10036
• Alternativnummer: ABT-ABO10036-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
• Alternative Synonym: Apoptosis regulator BAX, Bcl-2-like protein 4, Bcl2-L-4, BAX, BCL2L4

Produktbeschreibung

Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 21184
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder