Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10084
Artikelname: |
Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal |
Artikelnummer: |
ABT-ABO10084 |
Hersteller Artikelnummer: |
ABO10084 |
Alternativnummer: |
ABT-ABO10084-100UG |
Hersteller: |
Abcepta |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB, IHC-P |
Spezies Reaktivität: |
Human, Rat, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM). |
Alternative Synonym: |
Cytochrome P450 2D6, 1.14.14.1, CYPIID6, Cholesterol 25-hydroxylase, Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, CYP2D6, CYP2DL1 |
Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
Klonalität: |
Polyclonal |
Konzentration: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Molekulargewicht: |
55769 |
Antibody Type: |
Polyclonal Antibody |
Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |