Anti-ATP7b Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-ATP7b Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10101
• Hersteller Artikelnummer: ABO10101
• Alternativnummer: ABT-ABO10101-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
• Alternative Synonym: Copper-transporting ATPase 2, 3.6.3.54, Copper pump 2, Wilson disease-associated protein, WND/140 kDa, ATP7B, PWD, WC1, WND

Produktbeschreibung

Rabbit IgG polyclonal antibody for Copper-transporting ATPase 2(ATP7B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 157263
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder