Anti-EIF2C1/AGO1 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-EIF2C1/AGO1 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10115
• Hersteller Artikelnummer: ABO10115
• Alternativnummer: ABT-ABO10115-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR), identical to the related mouse and rat sequences.
• Alternative Synonym: Protein argonaute-1, Argonaute1, hAgo1, Argonaute RISC catalytic component 1, Eukaryotic translation initiation factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding protein Q99, AGO1, EIF2C1

Produktbeschreibung

Rabbit IgG polyclonal antibody for Protein argonaute-1(AGO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 97214
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder