Anti-HDGF Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-HDGF Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10143
• Hersteller Artikelnummer: ABO10143
• Alternativnummer: ABT-ABO10143-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
• Alternative Synonym: Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2

Produktbeschreibung

Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 26788
• NCBI: 3068
• UniProt: P51858
• Formulierung: Lyophilized
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder