Anti-HnRNP A1 Picoband Antibody, Rabbit, Polyclonal

Artikelnummer: ABT-ABO10189
Artikelname: Anti-HnRNP A1 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer: ABT-ABO10189
Hersteller Artikelnummer: ABO10189
Alternativnummer: ABT-ABO10189-100UG
Hersteller: Abcepta
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB, IHC-P
Spezies Reaktivität: Human, Rat, Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
Alternative Synonym: Heterogeneous nuclear ribonucleoprotein A1, hnRNP A1, Helix-destabilizing protein, Single-strand RNA-binding protein, hnRNP core protein A1, Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed, HNRNPA1, HNRPA1
Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Klonalität: Polyclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molekulargewicht: 38747
Antibody Type: Polyclonal Antibody
Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.