Anti-RPS6 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-RPS6 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10194
• Hersteller Artikelnummer: ABO10194
• Alternativnummer: ABT-ABO10194-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
• Alternative Synonym: 40S ribosomal protein S6, Phosphoprotein NP33, RPS6

Produktbeschreibung

Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 28681
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder