Anti-CHRNA5 Picoband Antibody, Rabbit, Polyclonal

Artikelnummer: ABT-ABO10244
Artikelname: Anti-CHRNA5 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer: ABT-ABO10244
Hersteller Artikelnummer: ABO10244
Alternativnummer: ABT-ABO10244-100UG
Hersteller: Abcepta
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Alternative Synonym: Neuronal acetylcholine receptor subunit alpha-5, CHRNA5, NACHRA5
Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Klonalität: Polyclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molekulargewicht: 53054
NCBI: 1138
UniProt: P30532
Formulierung: Lyophilized
Antibody Type: Polyclonal Antibody
Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.