Anti-EBP1 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-EBP1 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10259
• Hersteller Artikelnummer: ABO10259
• Alternativnummer: ABT-ABO10259-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB, IHC-P
• Spezies Reaktivität: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
• Alternative Synonym: Proliferation-associated protein 2G4, Cell cycle protein p38-2G4 homolog, hG4-1, ErbB3-binding protein 1, PA2G4, EBP1

Produktbeschreibung

Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 43787
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder