Anti-TECTA Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-TECTA Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10262
• Hersteller Artikelnummer: ABO10262
• Alternativnummer: ABT-ABO10262-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
• Alternative Synonym: Alpha-tectorin, TECTA

Produktbeschreibung

Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 239527
• NCBI: 7007
• UniProt: O75443
• Formulierung: Lyophilized
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder