Anti-GAD65 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-GAD65 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10278
• Hersteller Artikelnummer: ABO10278
• Alternativnummer: ABT-ABO10278-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
• Alternative Synonym: Glutamate decarboxylase 2, 4.1.1.15, 65 kDa glutamic acid decarboxylase, GAD-65, Glutamate decarboxylase 65 kDa isoform, GAD2, GAD65

Produktbeschreibung

Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 65411
• NCBI: 2572
• UniProt: Q05329
• Formulierung: Lyophilized
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder