Anti-MMP11 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-MMP11 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO10308
• Hersteller Artikelnummer: ABO10308
• Alternativnummer: ABT-ABO10308-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Alternative Synonym: Stromelysin-3, SL-3, ST3, 3.4.24.-, Matrix metalloproteinase-11, MMP-11, MMP11, STMY3

Produktbeschreibung

Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 54590
• NCBI: 4320
• UniProt: P24347
• Formulierung: Lyophilized
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder